ring finger protein 19A, Mouse, Clone: 4E4, Abnova™

Catalog No.	Quantity
89-001-530	200 μL

Catalog No. 89-001-530 Supplier Abnova Corporation Supplier No. H00025897M01A

Description

Mouse monoclonal antibody raised against a partial recombinant RNF19.

The protein encoded this gene contains two RING-finger motifs and an IBR (in between RING fingers) motif. This protein is an E3 ubiquintin ligase that is localized in Lewy bodies (LBs), a characteristic neuronal inclusion in Parkinson's disease (PD) brains. This protein interacts with UBE2L3/UBCH7 and UBE2E2/UBCH8, but not other ubiquitin-conjugating enzymes. This protein is found to bind and ubiquitylate synphilin 1 (SNCAIP), which is a interacting protein of alpha synuclein in neurons, and a major component of LB. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq]

Sequence: MKTSCSHGSSDYHTRFATVNILPEVENDRLENSPHQCSISVVTQTASCSEVSQLNHIAEEHGNNGIKPNVDLYFGDALKETNNNHSHQTMELKVAIQTE

Specifications

• Antigen: ring finger protein 19A
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4E4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RNF19.
• Formulation: ascites with no preservative
• Gene: RNF19A
• Gene Accession No.: NM_015435
• Gene Alias: DKFZp566B1346/DORFIN/RNF19
• Gene Symbols: RNF19A
• Host Species: Mouse
• Immunogen: RNF19 (NP_056250, 739 a.a. ∼ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Research Discipline: Ubiquitin/Proteasome
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 25897
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ