ring finger protein 2, Mouse, Clone: 6C2, Abnova™

Catalog No.	Quantity
89-014-179	100 μg

Catalog No. 89-014-179 Supplier Abnova Corporation Supplier No. H00006045M01

Description

Mouse monoclonal antibody raised against a partial recombinant RNF2.

Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. [provided by RefSeq

Sequence: PSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQ

Specifications

• Antigen: ring finger protein 2
• Applications: ELISA, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 6C2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RNF2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: RNF2
• Gene Accession No.: NM_007212
• Gene Alias: BAP-1/BAP1/DING/HIPI3/RING1B/RING2
• Gene Symbols: RNF2
• Host Species: Mouse
• Immunogen: RNF2 (NP_009143, 192 a.a. ∼ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6045
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ