Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89008560

ring finger protein 32, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89008560 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-008-560 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-008-560 Supplier Abnova Corporation Supplier No. H00140545B02

Description

Mouse polyclonal antibody raised against a full-length human RNF32 protein.

The protein encoded by this gene contains two RING ring finger motifs. RING finger motifs are present in a variety of functionally distinct proteins and are known to be involved in protein-DNA or protein-protein interactions. This gene was found to be expressed during spermatogenesis, most likely in spermatocytes and/or in spermatids. Several alternatively spliced transcript variants exist, but their full length natures are not clear. [provided by RefSeq

Sequence: MLKNKGHSSKKDNLAVNAVALQDHILHDLQLRNLSVADHSKTQVQKKENKSLKRDTKAIIDTGLKKTTQCPKLEDSEKEYVLDPKPPPLTLAQKLGLIGPPPPPLSSDEWEKVKQRSLLQGDSVQPCPICKEEFELRPQVLLSCSHVFHKACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGCVVRKWYRNLRKTVPPTDAKLRKNSLKKSSQKSATASCAHTTPTLKSSLQKSISAWP

Specifications

Antigen ring finger protein 32
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description ring finger protein 32
Formulation No additive
Gene RNF32
Gene Accession No. BC028120.1
Gene Alias FKSG33, HSD15
Gene Symbols RNF32
Host Species Mouse
Immunogen RNF32 (AAH28120.1, 1 a.a. ∽256 a.a) full-length human protein.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Ubiquitin/Proteasome
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 140545
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.