ROBO1, Mouse, Clone: 1F8, Abnova™

Catalog No.	Quantity
89-123-283	100 μg

Catalog No. 89-123-283 Supplier Abnova Corporation Supplier No. H00006091M03

Description

Mouse monoclonal antibody raised against a partial recombinant ROBO1.

Bilateral symmetric nervous systems have special midline structures that establish a partition between the two mirror image halves. Some axons project toward and across the midline in response to long-range chemoattractants emanating from the midline. The product of this gene is a member of the immunoglobulin gene superfamily and encodes an integral membrane protein that functions in axon guidance and neuronal precursor cell migration. This receptor is activated by SLIT-family proteins, resulting in a repulsive effect on glioma cell guidance in the developing brain. A related gene is located at an adjacent region on chromosome 3. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGA

Specifications

• Antigen: ROBO1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1F8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ROBO1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ROBO1
• Gene Accession No.: NM_002941
• Gene Alias: DUTT1/FLJ21882/MGC131599/MGC133277/SAX3
• Gene Symbols: ROBO1
• Host Species: Mouse
• Immunogen: ROBO1 (NP_002932, 491 a.a. ∼ 589 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6091
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ