ROBO2, Mouse, Clone: 4G5, Abnova™

Catalog No.	Quantity
89-123-114	200 μL

Catalog No. 89-123-114 Supplier Abnova Corporation Supplier No. H00006092M01A

Description

Mouse monoclonal antibody raised against a partial recombinant ROBO2.

This gene belongs to the ROBO family, part of the immunoglobulin superfamily proteins that are highly conserved from fly to human. The encoded protein is a receptor for SLIT2, molecules known to function in axon guidance and cell migration. Defects in this gene are the cause of vesicoureteral reflux type 2. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq

Sequence: ATGDPLPVISWLKEGFTFPGRDPRATIQEQGTLQIKNLRISDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDLSDLPGPPSKPQVTDVTKNSVTL

Specifications

• Antigen: ROBO2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4G5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ROBO2.
• Formulation: ascites with no preservative
• Gene: ROBO2
• Gene Accession No.: NM_002942
• Gene Alias: KIAA1568/SAX3
• Gene Symbols: ROBO2
• Host Species: Mouse
• Immunogen: ROBO2 (NP_002933, 441 a.a. ∼ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6092
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2b κ