ROD1 regulator of differentiation 1 (S. pombe), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ROD1.

Supplier:  Abnova Corporation H00009991A01

Catalog No. 89-004-460

Description

ROD1 is a functional homolog of nrd1, an S. pombe RNA-binding protein that suppresses the onset of differentiation.[supplied by OMIM

Sequence: GSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYY

Specifications

• Antigen: ROD1 regulator of differentiation 1 (S. pombe)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ROD1.
• Gene: ROD1
• Gene Alias: DKFZp781I1117/PTBP3
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 9991
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_005156
• Gene Symbols: ROD1
• Immunogen: ROD1 (NP_005147, 16 a.a. ∼ 114 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum