Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

receptor tyrosine kinase-like orphan receptor 1, Mouse, Clone: 2F8, Abnova™

Catalog No. 89014156 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-156 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-156 Supplier Abnova Corporation Supplier No. H00004919M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant ROR1.

The protein encoded by this gene is a receptor protein tyrosine kinase that modulates neurite growth in the central nervous system. It is a type I membrane protein and belongs to the ROR subfamily of cell surface receptors. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: ANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK

Specifications

Antigen receptor tyrosine kinase-like orphan receptor 1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2F8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ROR1.
Formulation PBS with no preservative; pH 7.4
Gene ROR1
Gene Accession No. BC006374
Gene Alias MGC99659/NTRKR1/dJ537F10.1
Gene Symbols ROR1
Host Species Mouse
Immunogen ROR1 (-, 294 a.a. ∼ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Primary or Secondary Primary
Gene ID (Entrez) 4919
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.