receptor tyrosine kinase-like orphan receptor 2, Mouse, Clone: 4B7, Abnova™

Catalog No.	Quantity
89-000-850	100 μg

Catalog No. 89-000-850 Supplier Abnova Corporation Supplier No. H00004920M05

Description

Mouse monoclonal antibody raised against a partial recombinant ROR2.

The protein encoded by this gene is a receptor protein tyrosine kinase and type I transmembrane protein that belongs to the ROR subfamily of cell surface receptors. The protein may be involved in the early formation of the chondrocytes and may be required for cartilage and growth plate development. Mutations in this gene can cause brachydactyly type B, a skeletal disorder characterized by hypoplasia/aplasia of distal phalanges and nails. In addition, mutations in this gene can cause the autosomal recessive form of Robinow syndrome, which is characterized by skeletal dysplasia with generalized limb bone shortening, segmental defects of the spine, brachydactyly, and a dysmorphic facial appearance. [provided by RefSeq

Sequence: EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKT

Specifications

• Antigen: receptor tyrosine kinase-like orphan receptor 2
• Applications: ELISA
• Classification: Monoclonal
• Clone: 4B7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ROR2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ROR2
• Gene Accession No.: NM_004560
• Gene Alias: BDB/BDB1/MGC163394/NTRKR2
• Gene Symbols: ROR2
• Host Species: Mouse
• Immunogen: ROR2 (NP_004551, 34 a.a. ∼ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4920
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ