Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ribosomal protein L29, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human RPL29 protein.

Manufacturer:  Abnova Corporation H00006159B02P

Catalog No. 89-016-899


  Check Availability
Add to cart

Specifications

Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 60S subunit. The protein belongs to the L29E family of ribosomal proteins. The protein is also a peripheral membrane protein expressed on the cell surface that directly binds heparin. Although this gene was previously reported to map to 3q29-qter, it is believed that it is located at 3p21.3-p21.2. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq

Sequence: MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAEAIKALVKPKEVKPKIPKGVSRKLDRLAYIAHPKLGKRARARIAKGLRLCRPKAKAKAKDQTKAQAAAPASVPAQAPKRTQAPTKASE
Description & Specifications

Specifications

ribosomal protein L29
Unlabeled
ribosomal protein L29
In 1X PBS, pH 7.4
NM_000992
RPL29
RPL29 (NP_000983.1, 1 a.a. ∽159 a.a) full-length human protein.
50μg
Human
Primary
6159
Immunofluorescence,Immunohistochemistry (Paraffin),Western Blot
Human
Affinity Purified
RPL29
HIP, HUMRPL29, MGC88589
Murine
Protein A column
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit