ribosomal protein L31, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-290	50 μL

Catalog No. 89-004-290 Supplier Abnova Corporation Supplier No. H00006160A01

Description

Mouse polyclonal antibody raised against a partial recombinant RPL31.

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L31E family of ribosomal proteins. It is located in the cytoplasm. Higher levels of expression of this gene in familial adenomatous polyps compared to matched normal tissues have been observed. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq

Sequence: VGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVDEN

Specifications

• Antigen: ribosomal protein L31
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RPL31.
• Formulation: 50% glycerol
• Gene: RPL31
• Gene Accession No.: NM_000993
• Gene Alias: MGC88191
• Gene Symbols: RPL31
• Host Species: Mouse
• Immunogen: RPL31 (NP_000984, 36 a.a. ∼ 125 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6160
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum