ribosomal protein L37a, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-291	50 μL

Catalog No. 89-004-291 Supplier Abnova Corporation Supplier No. H00006168A01

Description

Mouse polyclonal antibody raised against a partial recombinant RPL37A.

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L37AE family of ribosomal proteins. It is located in the cytoplasm. The protein contains a C4-type zinc finger-like domain. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq

Sequence: AKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRR

Specifications

• Antigen: ribosomal protein L37a
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RPL37A.
• Formulation: 50% glycerol
• Gene: RPL37A
• Gene Accession No.: NM_000998
• Gene Alias: MGC74786
• Gene Symbols: RPL37A
• Host Species: Mouse
• Immunogen: RPL37A (NP_000989, 2 a.a. ∼ 50 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6168
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum