Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ribosomal protein S6 kinase, 90kDa, polypeptide 1, Mouse, Clone: 2E3, Abnova™

Catalog No. 89000945 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-945 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-945 Supplier Abnova Corporation Supplier No. H00006195M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant RPS6KA1.

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: VAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSD

Specifications

Antigen ribosomal protein S6 kinase, 90kDa, polypeptide 1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2E3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RPS6KA1.
Formulation PBS with no preservative; pH 7.4
Gene RPS6KA1
Gene Accession No. NM_002953
Gene Alias HU-1/MAPKAPK1A/RSK/RSK1
Gene Symbols RPS6KA1
Host Species Mouse
Immunogen RPS6KA1 (NP_002944, 342 a.a. ∼ 416 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 6195
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.