ribosomal protein S6 kinase, 70kDa, polypeptide 1, Mouse, Clone: 1E10, Abnova™

Catalog No.	Quantity
89-000-946	100 μg

Catalog No. 89-000-946 Supplier Abnova Corporation Supplier No. H00006198M02

Description

Mouse monoclonal antibody raised against a partial recombinant RPS6KB1.

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this gene and overexpression of this kinase are seen in some breast cancer cell lines. Alternate translational start sites have been described and alternate transcriptional splice variants have been observed but have not been thoroughly characterized. [provided by RefSeq

Sequence: PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL

Specifications

• Antigen: ribosomal protein S6 kinase, 70kDa, polypeptide 1
• Applications: ELISA, Immunofluorescence, In situ PLA, Western Blot
• Classification: Cocktail
• Clone: 1E10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RPS6KB1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: RPS6KB1
• Gene Accession No.: NM_003161
• Gene Alias: PS6K/S6K/S6K1/STK14A/p70(S6K)-alpha/p70-S6K/p70-alpha
• Gene Symbols: RPS6KB1
• Host Species: Mouse
• Immunogen: RPS6KB1 (NP_003152, 416 a.a. ∼ 525 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6198
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: Ig Mix