Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000947

ribosomal protein S6 kinase, 70kDa, polypeptide 2, Mouse, Clone: 4B11, Abnova™

Catalog No. 89000947 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-947 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-947 Supplier Abnova Corporation Supplier No. H00006199M08
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant RPS6KB2.

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates the S6 ribosomal protein and eucaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation. [provided by RefSeq

Sequence: MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHSFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKV

Specifications

Antigen ribosomal protein S6 kinase, 70kDa, polypeptide 2
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 4B11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RPS6KB2.
Formulation PBS with no preservative; pH 7.4
Gene RPS6KB2
Gene Accession No. BC006106
Gene Alias KLS/P70-beta/P70-beta-1/P70-beta-2/S6K-beta2/S6K2/SRK/STK14B/p70(S6K)-beta/p70S6Kb
Gene Symbols RPS6KB2
Host Species Mouse
Immunogen RPS6KB2 (AAH06106, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 6199
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.