ribosomal protein SA, Mouse, Clone: 8G4, Abnova™

Catalog No.	Quantity
89-001-465	200 μL

Catalog No. 89-001-465 Supplier Abnova Corporation Supplier No. H00003921M01A

Description

Mouse monoclonal antibody raised against a partial recombinant RPSA.

Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Many of the effects of laminin are mediated through interactions with cell surface receptors. These receptors include members of the integrin family, as well as nonintegrin laminin-binding proteins. This gene encodes a high-affinity, nonintegrin family, laminin receptor 1. This receptor has been variously called 67kDa laminin receptor, 37kDa laminin receptor precursor (37LRP) and p40 ribosome-associated protein. The amino acid sequence of laminin receptor 1 is highly conserved through evolution, suggesting a key biological function. It has been observed that the level of the laminin receptor transcript is higher in colon carcinoma tissue and lung cancer cell line than their normal counterparts. Also, there is a correlation between the upregulation of this polypeptide in cancer cells and their invasive and metastatic phenotype. Multiple copies of this gene exist, however, most of them are pseudogenes thought to have arisen from retropositional events. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: EVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTDWS

Specifications

• Antigen: ribosomal protein SA
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 8G4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RPSA.
• Formulation: ascites with no preservative
• Gene: RPSA
• Gene Accession No.: NM_002295
• Gene Alias: 37LRP/67LR/LAMBR/LAMR1/LRP/p40
• Gene Symbols: RPSA
• Host Species: Mouse
• Immunogen: RPSA (NP_002286, 196 a.a. ∼ 295 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Research Discipline: Cell Adhesion
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3921
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ