ribonucleotide reductase M2 polypeptide, Mouse, Clone: 1E1, Abnova™

Catalog No.	Quantity
89-014-180	100 μg

Catalog No. 89-014-180 Supplier Abnova Corporation Supplier No. H00006241M01

Description

Mouse monoclonal antibody raised against a partial recombinant RRM2.

This gene encodes one of two nonidentical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq

Sequence: MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLS

Specifications

• Antigen: ribonucleotide reductase M2 polypeptide
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 1E1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RRM2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: RRM2
• Gene Accession No.: NM_001034
• Gene Alias: R2/RR2M
• Gene Symbols: RRM2
• Host Species: Mouse
• Immunogen: RRM2 (NP_001025, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 6241
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ