RUNX1T, Mouse, Clone: 5A12, Abnova™

Catalog No.	Quantity
89-016-458	100 μg

Catalog No. 89-016-458 Supplier Abnova Corporation Supplier No. H00000862M01

Description

Mouse monoclonal antibody raised against a partial recombinant RUNX1T1.

The protein encoded by this gene is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Several transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq]

Sequence: EEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICG

Specifications

• Antigen: RUNX1T
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 5A12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RUNX1T1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: RUNX1T1
• Gene Accession No.: NM_004349
• Gene Alias: AML1T1/CBFA2T1/CDR/ETO/MGC2796/MTG8/MTG8b/ZMYND2
• Gene Symbols: RUNX1T1
• Host Species: Mouse
• Immunogen: RUNX1T1 (NP_004340, 416 a.a. ∼ 525 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 862
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ