runt-related transcription factor 3 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-049	50 μL

Catalog No. 89-004-049 Supplier Abnova Corporation Supplier No. H00000864A01

Description

Mouse polyclonal antibody raised against a partial recombinant RUNX3.

This gene encodes a member of the runt domain-containing family of transcription factors. A heterodimer of this protein and a beta subunit forms a complex that binds to the core DNA sequence 5'-PYGPYGGT-3' found in a number of enhancers and promoters, and can either activate or suppress transcription. It also interacts with other transcription factors. It functions as a tumor suppressor, and the gene is frequently deleted or transcriptionally silenced in cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: FPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFP

Specifications

• Antigen: runt-related transcription factor 3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RUNX3.
• Formulation: 50% glycerol
• Gene: RUNX3
• Gene Accession No.: NM_004350
• Gene Alias: AML2/CBFA3/FLJ34510/MGC16070/PEBP2aC
• Gene Symbols: RUNX3
• Host Species: Mouse
• Immunogen: RUNX3 (NP_004341, 194 a.a. ∼ 279 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 864
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum