S100 calcium binding protein A1, Mouse, Clone: 1D5, Abnova™

Catalog No.	Quantity
89-014-181	100 μg

Catalog No. 89-014-181 Supplier Abnova Corporation Supplier No. H00006271M01

Description

Mouse monoclonal antibody raised against a partial recombinant S100A1.

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-induced Ca2+ release, inhibition of microtubule assembly, and inhibition of protein kinase C-mediated phosphorylation. Reduced expression of this protein has been implicated in cardiomyopathies. [provided by RefSeq]

Sequence: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEY

Specifications

• Antigen: S100 calcium binding protein A1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1D5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant S100A1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: S100A1
• Gene Accession No.: NM_006271
• Gene Alias: S100/S100-alpha/S100A
• Gene Symbols: S100A1
• Host Species: Mouse
• Immunogen: S100A1 (NP_006262, 1 a.a. ∼ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Neurobiology
• Primary or Secondary: Primary
• Gene ID (Entrez): 6271
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ