S100 calcium binding protein A4, Mouse, Clone: 1F12-1G7, Abnova™

Catalog No.	Quantity
89-014-182	100 μg

Catalog No. 89-014-182 Supplier Abnova Corporation Supplier No. H00006275M01

Description

Mouse monoclonal antibody raised against a full-length recombinant S100A4.

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq

Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK

Specifications

• Antigen: S100 calcium binding protein A4
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1F12-1G7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant S100A4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: S100A4
• Gene Accession No.: BC016300
• Gene Alias: 18A2/42A/CAPL/FSP1/MTS1/P9KA/PEL98
• Gene Symbols: S100A4
• Host Species: Mouse
• Immunogen: S100A4 (AAH16300, 1 a.a. ∼ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6275
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ