Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

S100 calcium binding protein A6, Mouse, Clone: 6D1, Abnova™

Catalog No. 89000950 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-950 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-950 Supplier Abnova Corporation Supplier No. H00006277M16
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant S100A6.

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma. [provided by RefSeq]

Sequence: KYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYSEALKG

Specifications

Antigen S100 calcium binding protein A6
Applications ELISA, Western Blot
Classification Monoclonal
Clone 6D1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant S100A6.
Formulation PBS with no preservative; pH 7.4
Gene S100A6
Gene Accession No. NM_014624
Gene Alias 2A9/5B10/CABP/CACY/PRA
Gene Symbols S100A6
Host Species Mouse
Immunogen S100A6 (NP_055439, 18 a.a. ∼ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 6277
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.