S100 calcium binding protein A7, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human S100A7 protein.

Manufacturer: Abnova Corporation H00006278D03P

Catalog No. 89-018-440

  Check Availability
Add to Cart

    Specifications

    Antigen S100 calcium binding protein A7
    Applications Western Blotting
    Conjugate Unlabeled
    Cross Reactivity Human
    Description S100 calcium binding protein A7
    Format Affinity Purified
    Formulation In 1X PBS, pH 7.4
    Gene S100A7
    Gene Accession No. BC034687
    Gene Alias PSOR1, S100A7c
    Gene Symbols S100A7
    Host Species Rabbit
    Immunogen S100A7 (AAH34687, 1 a.a. ∽102 a.a) full-length human protein.
    Purification Method Protein A column
    Quantity 100μg
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Polyclonal
    Gene ID (Entrez) 6278

    The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility. The exact function of this protein is not known. [provided by RefSeq

    Sequence: MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit