Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

S100 calcium binding protein A7, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human S100A7 protein.

Manufacturer:  Abnova Corporation H00006278D03P

Catalog No. 89-018-440


  Check Availability
Add to cart

Specifications

Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility. The exact function of this protein is not known. [provided by RefSeq

Sequence: MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Description & Specifications

Specifications

S100 calcium binding protein A7
Unlabeled
In 1X PBS, pH 7.4
BC034687
PSOR1, S100A7c
Rabbit
Protein A column
RUO
Primary
6278
Western Blot
S100 calcium binding protein A7
S100A7
Affinity Purified
S100A7
S100A7 (AAH34687, 1 a.a. ∽102 a.a) full-length human protein.
100μg
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit