S100 calcium binding protein A8, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human S100A8 protein.

Supplier:  Abnova Corporation H00006279B01

Catalog No. 89-006-185

Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. [provided by RefSeq

Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Specifications

• Antigen: S100 calcium binding protein A8
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human S100A8 protein.
• Gene: S100A8
• Gene Alias: 60B8AG/CAGA/CFAG/CGLA/CP-10/L1Ag/MA387/MIF/MRP8/NIF/P8
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 6279
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: BC005928
• Gene Symbols: S100A8
• Immunogen: S100A8 (AAH05928, 1 a.a. ∼ 93 a.a) full-length human protein.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum