Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014325

sal-like 4 (Drosophila), Mouse, Clone: 6E3, Abnova™

Catalog No. 89014325 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-325 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-325 Supplier Abnova Corporation Supplier No. H00057167M03
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant SALL4.

The protein encoded by this gene may be a zinc finger transcription factor. Defects in this gene are a cause of Duane-radial ray syndrome (DRRS). [provided by RefSeq

Sequence: PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS

Specifications

Antigen sal-like 4 (Drosophila)
Applications ELISA, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 6E3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SALL4.
Formulation PBS with no preservative; pH 7.4
Gene SALL4
Gene Accession No. NM_020436
Gene Alias DRRS/HSAL4/MGC133050/ZNF797/dJ1112F19.1
Gene Symbols SALL4
Host Species Mouse
Immunogen SALL4 (NP_065169, 954 a.a. ∼ 1053 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57167
Target Species Human, Mouse
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.