salvador homolog 1 (Drosophila), Mouse, Clone: 3B2, Abnova™

Catalog No.	Quantity
89-014-329	100 μg

Catalog No. 89-014-329 Supplier Abnova Corporation Supplier No. H00060485M02

Description

Mouse monoclonal antibody raised against a partial recombinant SAV1.

WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 2 WW domains and a coiled-coil region. It is ubiquitously expressed in adult tissues. The encoded protein is 94% identical to the mouse protein at the amino acid level. [provided by RefSeq

Sequence: HTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKMYEAYRQALLTELENRKQRQQWYAQQHGKNF

Specifications

• Antigen: salvador homolog 1 (Drosophila)
• Applications: ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 3B2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SAV1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SAV1
• Gene Accession No.: NM_021818
• Gene Alias: SAV/WW45/WWP4
• Gene Symbols: SAV1
• Host Species: Mouse
• Immunogen: SAV1 (NP_068590, 300 a.a. ∼ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 60485
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ