SCAN domain containing 2 pseudogene, Mouse, Clone: 5F1, Abnova™

Catalog No.	Quantity
89-001-300	100 μg

Catalog No. 89-001-300 Supplier Abnova Corporation Supplier No. H00054581M02

Description

Mouse monoclonal antibody raised against a partial recombinant SCAND2.

The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. This gene belongs to a family of genes that encode an isolated SCAN domain, but no zinc finger motif. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity. Multiple transcript variants which encode the same isoform but differ only in their 3' UTRs, and another variant which encodes a distinct isoform have been described for this gene.

Sequence: MAVAVDQQIQTPSVQDLQIVKLEEDSHWEQEISLQGNYPGPETSCQSFWHFRYQEASRPREA

Specifications

• Antigen: SCAN domain containing 2 pseudogene
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 5F1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SCAND2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SCAND2
• Gene Accession No.: NM_022050
• Gene Symbols: SCAND2
• Host Species: Mouse
• Immunogen: SCAND2 (NP_071333, 1 a.a. ∼ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 54581
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ