src kinase associated phosphoprotein 1, Mouse, Clone: 1C11, Abnova™

Catalog No.	Quantity
89-001-094	100 μg

Catalog No. 89-001-094 Supplier Abnova Corporation Supplier No. H00008631M02

Description

Mouse monoclonal antibody raised against a partial recombinant SCAP1.

This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins. [provided by RefSeq

Sequence: MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVK

Specifications

• Antigen: src kinase associated phosphoprotein 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1C11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SCAP1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SKAP1
• Gene Accession No.: NM_003726
• Gene Alias: SCAP1/SKAP55
• Gene Symbols: SKAP1
• Host Species: Mouse
• Immunogen: SCAP1 (NP_003717, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 8631
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ