Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89005758

secretoglobin, family 2A, member 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89005758 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-005-758 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-005-758 Supplier Abnova Corporation Supplier No. H00004250B01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a full-length human SCGB2A2 protein.

Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF

Specifications

Antigen secretoglobin, family 2A, member 2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length human SCGB2A2 protein.
Formulation No additive
Gene SCGB2A2
Gene Accession No. NM_002411.1
Gene Alias MGB1/MGC71974/UGB2
Gene Symbols SCGB2A2
Host Species Mouse
Immunogen SCGB2A2 (AAI28403.1, 1 a.a. ∼ 93 a.a) full-length human protein.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 4250
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.