Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000959

succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa, Mouse, Clone: 3G7, Abnova™

Catalog No. 89000959 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-959 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-959 Supplier Abnova Corporation Supplier No. H00006391M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant SDHC.

This gene encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. Several related pseudogenes are located in different genomic regions. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq

Sequence: MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM

Specifications

Antigen succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3G7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant SDHC.
Formulation PBS with no preservative; pH 7.4
Gene SDHC
Gene Accession No. BC033626
Gene Alias CYB560/CYBL/PGL3/QPS1/SDH3
Gene Symbols SDHC
Host Species Mouse
Immunogen SDHC (AAH33626, 1 a.a. ∼ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 6391
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.