Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89006215

secreted and transmembrane 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89006215 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-006-215 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-006-215 Supplier Abnova Corporation Supplier No. H00006398B02

Description

Mouse polyclonal antibody raised against a full-length human SECTM1 protein.

This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes. [provided by RefSeq

Sequence: MQTCPLAFPGHVSQALGTLLFLAASLSAQNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKVAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP

Specifications

Antigen secreted and transmembrane 1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description secreted and transmembrane 1
Formulation No additive
Gene SECTM1
Gene Accession No. NM_003004.1
Gene Alias K12
Gene Symbols SECTM1
Host Species Mouse
Immunogen SECTM1 (NP_002995.1, 1 a.a. ∽248 a.a) full-length human protein.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Cytokines
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 6398
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.