secreted and transmembrane 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human SECTM1 protein.

Supplier:  Abnova Corporation H00006398B02

Catalog No. 89-006-215

Description

This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes. [provided by RefSeq

Sequence: MQTCPLAFPGHVSQALGTLLFLAASLSAQNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKVAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP

Specifications

• Antigen: secreted and transmembrane 1
• Classification: Polyclonal
• Description: secreted and transmembrane 1
• Gene: SECTM1
• Gene Alias: K12
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Cytokines
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_003004.1
• Gene Symbols: SECTM1
• Immunogen: SECTM1 (NP_002995.1, 1 a.a. ∽248 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 6398
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.