selenoprotein S (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-007-902	50 μL

Catalog No. 89-007-902 Supplier Abnova Corporation Supplier No. H00055829B01

Description

Mouse polyclonal antibody raised against a full-length human SELS protein.

This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies suggest that this protein may regulate cytokine production, and thus play a key role in the control of the inflammatory response. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Sequence: MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEVWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGG*G

Specifications

• Antigen: selenoprotein S
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human SELS protein.
• Formulation: No additive
• Gene: SELS
• Gene Accession No.: BC005840
• Gene Alias: AD-015/ADO15/MGC104346/MGC2553/SBBI8/SEPS1/VIMP
• Gene Symbols: SELS
• Host Species: Mouse
• Immunogen: SELS (AAH05840, 1 a.a. ∼ 189 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 55829
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum