Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SEMA3B, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SEMA3B.

Manufacturer:  Abnova Corporation H00007869A01

Catalog No. 89-003-100


Add to cart

Description

Description

The semaphorin/collapsin family of molecules plays a critical role in the guidance of growth cones during neuronal development. The secreted protein encoded by this gene family member is important in axonal guidance and has been shown to act as a tumor suppressor by inducing apoptosis. [provided by RefSeq

Sequence: FTQPLRRLSLHVLSATQAERLARAEEAAPAAPPGPKLWYRDFLQLVEPGGGGSANSLRMCRPQPALQSLPLESRRKGRNRRTHAPEPRAERGPRSATH
Specifications

Specifications

SEMA3B
Unconjugated
50% glycerol
NM_004636
FLJ34863|LUCA-1|SEMA5|SEMAA|SemA|semaV
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant SEMA3B.
SEMA3B
Liquid
SEMA3B
SEMA3B (NP_004627, 651 a.a. ~ 748 a.a) partial recombinant protein with GST tag.
RUO
Primary
7869
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit