Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89002652

SEMA4A, Mouse, Clone: 4E2, Abnova™

Catalog No. 89002652 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-002-652 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-002-652 Supplier Abnova Corporation Supplier No. H00064218M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant SEMA4A.

SEMA4A is a member of the semaphorin family of soluble and transmembrane proteins. Semaphorins are involved in guidance of axonal migration during neuronal development and in immune responses.[supplied by OMIM

Sequence: GGGQGPMPRVRYYAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLV

Specifications

Antigen SEMA4A
Applications ELISA
Classification Monoclonal
Clone 4E2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SEMA4A.
Formulation PBS with no preservative; pH 7.4
Gene SEMA4A
Gene Accession No. NM_022367
Gene Alias CORD10/FLJ12287/RP35/SEMAB/SEMB
Gene Symbols SEMA4A
Host Species Mouse
Immunogen SEMA4A (NP_071762, 33 a.a. ∼ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64218
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.