Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014263

sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D, Mouse, Clone: 3B4, Abnova™

Catalog No. 89014263 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-263 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-263 Supplier Abnova Corporation Supplier No. H00010507M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant SEMA4D.

Sequence: LQPLSATSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSP

Specifications

Antigen sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3B4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SEMA4D.
Formulation PBS with no preservative; pH 7.4
Gene SEMA4D
Gene Accession No. BC054500
Gene Alias C9orf164/CD100/FLJ33485/FLJ34282/FLJ39737/FLJ46484/M-sema-G/MGC169138/MGC169141/SEMAJ/coll-4
Gene Symbols SEMA4D
Host Species Mouse
Immunogen SEMA4D (AAH54500, 115 a.a. ∼ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Apoptosis
Primary or Secondary Primary
Gene ID (Entrez) 10507
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.