sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D, Mouse, Clone: 3B4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SEMA4D.

Supplier:  Abnova Corporation H00010507M01

Catalog No. 89-014-263

Description

Sequence: LQPLSATSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSP

Specifications

• Antigen: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC054500
• Gene Symbols: SEMA4D
• Immunogen: SEMA4D (AAH54500, 115 a.a. ∼ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Apoptosis
• Gene ID (Entrez): 10507
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ

• Applications: ELISA, Western Blot
• Clone: 3B4
• Description: Mouse monoclonal antibody raised against a partial recombinant SEMA4D.
• Gene: SEMA4D
• Gene Alias: C9orf164/CD100/FLJ33485/FLJ34282/FLJ39737/FLJ46484/M-sema-G/MGC169138/MGC169141/SEMAJ/coll-4
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody