SEMA4G, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SEMA4G.

Supplier:  Abnova Corporation H00057715A01

Catalog No. 89-003-164

Description

Semaphorins are a large family of conserved secreted and membrane associated proteins which possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Based on sequence and structural similarities, semaphorins are put into eight classes: invertebrates contain classes 1 and 2, viruses have class V, and vertebrates contain classes 3-7. Semaphorins serve as axon guidance ligands via multimeric receptor complexes, some (if not all) containing plexin proteins. This gene encodes a class 4 semaphorin. This gene and the gene for mitochondrial ribosomal protein L43 overlap at map location 10q24.31 and are transcribed in opposite directions. [provided by RefSeq

Sequence: RRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCHQKGKNNQTEC

Specifications

• Antigen: SEMA4G
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SEMA4G.
• Gene: SEMA4G
• Gene Alias: FLJ20590/KIAA1619/MGC102867
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_017893
• Gene Symbols: SEMA4G
• Immunogen: SEMA4G (NP_060363, 24 a.a. ∼ 115 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 57715
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.