SEMA4G, Mouse, Clone: 3F2, Abnova™

Catalog No.	Quantity
89-002-650	100 μg

Catalog No. 89-002-650 Supplier Abnova Corporation Supplier No. H00057715M01

Description

Mouse monoclonal antibody raised against a partial recombinant SEMA4G.

Semaphorins are a large family of conserved secreted and membrane associated proteins which possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Based on sequence and structural similarities, semaphorins are put into eight classes: invertebrates contain classes 1 and 2, viruses have class V, and vertebrates contain classes 3-7. Semaphorins serve as axon guidance ligands via multimeric receptor complexes, some (if not all) containing plexin proteins. This gene encodes a class 4 semaphorin. This gene and the gene for mitochondrial ribosomal protein L43 overlap at map location 10q24.31 and are transcribed in opposite directions. [provided by RefSeq

Sequence: RRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCHQKGKNNQTEC

Specifications

• Antigen: SEMA4G
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3F2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SEMA4G.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SEMA4G
• Gene Accession No.: NM_017893
• Gene Alias: FLJ20590/KIAA1619/MGC102867
• Gene Symbols: SEMA4G
• Host Species: Mouse
• Immunogen: SEMA4G (NP_060363, 24 a.a. ∼ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 57715
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ