SEMA7A, Mouse, Clone: 1G1, Abnova™

Catalog No.	Quantity
89-002-729	100 μg

Catalog No. 89-002-729 Supplier Abnova Corporation Supplier No. H00008482M06

Description

Mouse monoclonal antibody raised against a partial recombinant SEMA7A.

The protein encoded by this gene binds to cell surfaces through a glycosylphosphatidylinositol (GPI) linkage. The encoded glycoprotein is found on activated lymphocytes and erythrocytes. This protein may be involved in immunomodulatory and neuronal processes. Defects in this gene can result in loss of bone mineral density (BMD). Three transcript variants encoding different isoforms have been found for this gene

Sequence: EPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPED

Specifications

• Antigen: SEMA7A,
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1G1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SEMA7A.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SEMA7A
• Gene Accession No.: NM_003612
• Gene Alias: CD108/CDw108/H-SEMA-K1/H-Sema-L/JMH/MGC126692/MGC126696/SEMAK1/SEMAL
• Gene Symbols: SEMA7A
• Host Species: Mouse
• Immunogen: SEMA7A (NP_003603, 536 a.a. ∼ 633 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8482
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ