Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SEMA7A, Mouse, Clone: 1G1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SEMA7A.

Manufacturer:  Abnova Corporation H00008482M06

Catalog No. 89-002-729


Add to cart

Description

Description

The protein encoded by this gene binds to cell surfaces through a glycosylphosphatidylinositol (GPI) linkage. The encoded glycoprotein is found on activated lymphocytes and erythrocytes. This protein may be involved in immunomodulatory and neuronal processes. Defects in this gene can result in loss of bone mineral density (BMD). Three transcript variants encoding different isoforms have been found for this gene

Sequence: EPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPED
Specifications

Specifications

SEMA7A,
1G1
Mouse monoclonal antibody raised against a partial recombinant SEMA7A.
SEMA7A
Liquid
SEMA7A
SEMA7A (NP_003603, 536 a.a. ~ 633 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA, Immunofluorescence, Western Blot
Unconjugated
In 1X PBS, pH 7.4
NM_003612
CD108|CDw108|H-SEMA-K1|H-Sema-L|JMH|MGC126692|MGC126696|SEMAK1|SEMAL
Mouse
IgG2a Kappa
RUO
Primary
8482
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit