semenogelin I, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-016-902	50 μg

Catalog No. 89-016-902 Supplier Abnova Corporation Supplier No. H00006406B01P

Description

Mouse polyclonal antibody raised against a full-length human SEMG1 protein.

The protein encoded by this gene is the predominant protein in semen. The encoded secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely. [provided by RefSeq

Sequence: MKPNIIFVLSLLLILEKQAAVMGQKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDQNPLFT

Specifications

• Antigen: semenogelin I
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human SEMG1 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SEMG1
• Gene Accession No.: BC007096.1
• Gene Alias: MGC14719/SEMG/SGI
• Gene Symbols: SEMG1
• Host Species: Mouse
• Immunogen: SEMG1 (AAH07096.1, 1 a.a. ∼ 402 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6406
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG