SUMO/sentrin specific peptidase family member 8, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-018-666	100 μg

Catalog No. 89-018-666 Supplier Abnova Corporation Supplier No. H00123228D01P

Description

Rabbit polyclonal antibody raised against a full-length human SENP8 protein.

NEDD8 (MIM 603171) is a ubiquitin-like protein that becomes conjugated to the cullin (see CUL1; MIM 603134) subunit of several ubiquitin ligases. This conjugation, called neddylation, is required for optimal ubiquitin ligase activity. NEDD8-specific deneddylases, such as NEDP1, or DEN1, are required to process the NEDD8 propeptide at a C-terminal diglycine motif and to remove NEDD8 from cullins (Gan-Erdene et al., 2003 [PubMed 12759363]).[supplied by OMIM]

Sequence: MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK

Specifications

• Antigen: SUMO/sentrin specific peptidase family member 8
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human SENP8 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SENP8
• Gene Accession No.: NM_145204.2
• Gene Alias: DEN1/HsT17512/NEDP1/PRSC2
• Gene Symbols: SENP8
• Host Species: Rabbit
• Immunogen: SENP8 (NP_660205.2, 1 a.a. ∼ 212 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Ubiquitin/Proteasome
• Primary or Secondary: Primary
• Gene ID (Entrez): 123228
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG