Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SEPT1, Rabbit, MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human SEPT1 protein.

Supplier: Abnova Corporation H00001731D01

Catalog No. 89-002-888

$591.50 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis. This gene encodes a protein associated with the tau-based paired helical filament core, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease. [provided by RefSeq]

Sequence: MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKMQAQMQQSQAQGEQSDAL

Specifications

Antigen	Septin 1
Classification	Polyclonal
Description	Rabbit polyclonal antibody raised against a full-length human SEPT1 protein.
Gene	SEPT1
Gene Alias	DIFF6/LARP/MGC20394/PNUTL3/SEP1
Host Species	Rabbit
Quantity	100 μL
Primary or Secondary	Primary
Target Species	Human
Form	Liquid

Applications	Immunoprecipitation, Western Blot
Conjugate	Unconjugated
Formulation	No additive
Gene Accession No.	NM_052838
Gene Symbols	SEPT1
Immunogen	SEPT1 (NP_443070.1, 1 a.a. ∼ 367 a.a) full-length human protein.
Regulatory Status	RUO
Gene ID (Entrez)	1731
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

SEPT1, Rabbit, MaxPab™ Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions