Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SEPT3, Mouse, Clone: 1F6, Abnova™

Catalog No. 89002640 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-002-640 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-002-640 Supplier Abnova Corporation Supplier No. H00055964M05
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant SEPT3.

This gene belongs to the septin family of GTPases. Members of this family are required for cytokinesis. Expression is upregulated by retinoic acid in a human teratocarcinoma cell line. The specific function of this gene has not been determined. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq

Sequence: TENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE

Specifications

Antigen Septin 3
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1F6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SEPT3.
Formulation PBS with no preservative; pH 7.4
Gene SEPT3
Gene Accession No. NM_145733
Gene Alias MGC133218/SEP3/bK250D10.3
Gene Symbols SEPT3
Host Species Mouse
Immunogen SEPT3 (NP_663786, 236 a.a. ∼ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55964
Target Species Human, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.