Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SEPT3, Mouse, Clone: 1F6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SEPT3.

Manufacturer:  Abnova Corporation H00055964M05

Catalog No. 89-002-640


Add to cart

Description

Description

This gene belongs to the septin family of GTPases. Members of this family are required for cytokinesis. Expression is upregulated by retinoic acid in a human teratocarcinoma cell line. The specific function of this gene has not been determined. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq

Sequence: TENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE
Specifications

Specifications

Septin 3
1F6
Mouse monoclonal antibody raised against a partial recombinant SEPT3.
SEPT3
Liquid
SEPT3
SEPT3 (NP_663786, 236 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human, Rat
ELISA, Western Blot
Unconjugated
In 1X PBS, pH 7.4
NM_145733
MGC133218|SEP3|bK250D10.3
Mouse
IgG1 Kappa
RUO
Primary
55964
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit