septin 9, Mouse, Clone: 2C6, Abnova™

Catalog No.	Quantity
89-001-194	100 μg

Catalog No. 89-001-194 Supplier Abnova Corporation Supplier No. H00010801M01

Description

Mouse monoclonal antibody raised against a partial recombinant SEPT9.

This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described

Sequence: PRRVQTPLLRATVASSTQKFQDLGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTP

Specifications

• Antigen: Septin-9
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2C6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SEPT9.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SEPT9
• Gene Accession No.: BC021192
• Gene Alias: AF17q25/FLJ75490/KIAA0991/MSF/MSF1/NAPB/PNUTL4/SINT1/SeptD1
• Gene Symbols: SEPT9
• Host Species: Mouse
• Immunogen: SEPT9 (AAH21192, 26 a.a. ∼ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 10801
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ