Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

serpin peptidase inhibitor, clade B (ovalbumin), member 3, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human SERPINB3 protein.

Manufacturer:  Abnova Corporation H00006317D01P

Catalog No. 89-018-447


  Check Availability
Add to cart

Specifications

Description

Sequence: MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Description & Specifications

Specifications

serpin peptidase inhibitor, clade B (ovalbumin), member 3
Unlabeled
serpin peptidase inhibitor, clade B (ovalbumin), member 3
In 1X PBS, pH 7.4
NM_006919.1
SERPINB3
SERPINB3 (NP_008850.1, 1 a.a. ∽390 a.a) full-length human protein.
100μg
Human
Primary
6317
Western Blot
Human
Affinity Purified
SERPINB3
HsT1196, SCC, SCCA-1, SCCA-PD, SCCA1, T4-A
Rabbit
Protein A column
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit