Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

serum/glucocorticoid regulated kinase 2, Mouse, Clone: 1A7, Abnova™

Catalog No. 89014253 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-253 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-253 Supplier Abnova Corporation Supplier No. H00010110M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant SGK2.

This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Two alternate transcripts encoding two different isoforms have been described. [provided by RefSeq

Sequence: SPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC

Specifications

Antigen serum/glucocorticoid regulated kinase 2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1A7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SGK2.
Formulation PBS with no preservative; pH 7.4
Gene SGK2
Gene Accession No. BC065511
Gene Alias H-SGK2/dJ138B7.2
Gene Symbols SGK2
Host Species Mouse
Immunogen SGK2 (AAH65511, 293 a.a. ∼ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10110
Target Species Human, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.