serum/glucocorticoid regulated kinase 2, Mouse, Clone: 4G4, Abnova™

Catalog No.	Quantity
89-001-164	100 μg

Catalog No. 89-001-164 Supplier Abnova Corporation Supplier No. H00010110M05

Description

Mouse monoclonal antibody raised against a partial recombinant SGK2.

This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Two alternate transcripts encoding two different isoforms have been described. [provided by RefSeq

Sequence: SPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC

Specifications

• Antigen: serum/glucocorticoid regulated kinase 2
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 4G4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SGK2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SGK2
• Gene Accession No.: BC065511
• Gene Alias: H-SGK2/dJ138B7.2
• Gene Symbols: SGK2
• Host Species: Mouse
• Immunogen: SGK2 (AAH65511, 293 a.a. ∼ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 10110
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG3 κ