SH2 domain protein 1A, Mouse, Clone: 1C9, Abnova™

Catalog No.	Quantity
89-014-144	100 μg

Catalog No. 89-014-144 Supplier Abnova Corporation Supplier No. H00004068M01

Description

Mouse monoclonal antibody raised against a full-length recombinant SH2D1A.

This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP

Specifications

• Antigen: SH2 domain protein 1A
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1C9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant SH2D1A.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SH2D1A
• Gene Accession No.: BC020732
• Gene Alias: DSHP/EBVS/FLJ18687/FLJ92177/IMD5/LYP/MTCP1/SAP/XLP/XLPD
• Gene Symbols: SH2D1A
• Host Species: Mouse
• Immunogen: SH2D1A (AAH20732, 1 a.a. ∼ 128 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Gene ID (Entrez): 4068
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ