SH2 domain protein 1A, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human SH2D1A protein.

Supplier:  Abnova Corporation H00004068D01P

Catalog No. 89-017-822

Description

This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP

Specifications

• Antigen: SH2 domain protein 1A
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human SH2D1A protein.
• Gene: SH2D1A
• Gene Alias: DSHP/EBVS/FLJ18687/FLJ92177/IMD5/LYP/MTCP1/SAP/XLP/XLPD
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_002351
• Gene Symbols: SH2D1A
• Immunogen: SH2D1A (NP_002342.1, 1 a.a. ∼ 128 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Membrane Receptors
• Gene ID (Entrez): 4068
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG