Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001162

SH2 domain containing 3C, Mouse, Clone: 3C5, Abnova™

Catalog No. 89001162 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-162 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-162 Supplier Abnova Corporation Supplier No. H00010044M07
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant SH2D3C.

Sequence: MTAVGRRCPALGSRGAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKI

Specifications

Antigen SH2 domain containing 3C
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3C5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SH2D3C.
Formulation PBS with no preservative; pH 7.4
Gene SH2D3C
Gene Accession No. NM_005489
Gene Alias CHAT/FLJ39664/NSP3/PRO34088
Gene Symbols SH2D3C
Host Species Mouse
Immunogen SH2D3C (NP_005480, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Signal Transduction
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 10044
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.