sex hormone-binding globulin, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-307	50 μL

Catalog No. 89-004-307 Supplier Abnova Corporation Supplier No. H00006462A01

Description

Mouse polyclonal antibody raised against a partial recombinant SHBG.

This gene encodes a steroid binding protein that was first described as a plasma protein secreted by the liver but is now thought to participate in the regulation of steroid responses. The encoded protein binds each steroid molecule as a dimer formed from identical or nearly identical monomers. The use of alternate promoters and alternatively spliced transcripts have been described. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: DPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDS

Specifications

• Antigen: sex hormone-binding globulin
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SHBG.
• Formulation: 50% glycerol
• Gene: SHBG
• Gene Accession No.: NM_001040
• Gene Alias: ABP/MGC126834/MGC138391/TEBG
• Gene Symbols: SHBG
• Host Species: Mouse
• Immunogen: SHBG (NP_001031, 41 a.a. ∼ 140 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6462
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum