serine hydroxymethyltransferase 1 (soluble) (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-308	50 μL

Catalog No. 89-004-308 Supplier Abnova Corporation Supplier No. H00006470A01

Description

Mouse polyclonal antibody raised against a partial recombinant SHMT1.

This gene encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq

Sequence: EKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPD

Specifications

• Antigen: serine hydroxymethyltransferase 1 (soluble)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SHMT1.
• Formulation: 50% glycerol
• Gene: SHMT1
• Gene Accession No.: NM_004169
• Gene Alias: CSHMT/MGC15229/MGC24556/SHMT
• Gene Symbols: SHMT1
• Host Species: Mouse
• Immunogen: SHMT1 (NP_004160, 374 a.a. ∼ 482 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6470
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum